McDonnell Genome Institute

Washington University

Transcript

lnc-STK35-3:1

Chromosome

chr20

Gene Name

lnc-STK35-3

Start

2075554

CPC Label

noncoding

End

2075822

Cancer

EOGC

Strand

+

Peptide

LHGGSDYEIYTVGK

Modified Peptide

n[145]LHGGSDYEIYTVGK

Peptide Length

14

ORF Length

36

Open Reading Frame (ORF)

LHGGSDYEIYTVGKRFKEANNFLWPFKLFSPRGGMK

Conservation Score

1

PhyloCSF Frame 1

-4.365

No. of Spectra

5

CPC Coding Probability

0.0114386

PhyloCSF Frame 2 

-4.571

CNTI Index

noncoding

Max Probability

0.9943

PhyloCSF Frame 3

-4.344

CNTI Score

-0.415448114