McDonnell Genome Institute

Washington University

Transcript

lnc-STK32C-2:2

Chromosome

chr10

Gene Name

lnc-STK32C-2

Start

132421762

CPC Label

coding

End

132444982

Cancer

OSCC

Strand

-

Peptide

GGILPSTEPVCSSTQSPFLKAGGLQDR

Modified Peptide

n[145]GGILPSTEPVCSSTQSPFLKAGGLQDR

Peptide Length

27

ORF Length

108

Open Reading Frame (ORF)

LLRLPVLEVRLEPSYLSKGGILPSTEPVCSSTQSPFLKAGGLQDRSQARSRPHLVHMACLWCGARSRSSRNMPQQPSTFQRALHTGMHEEAVRSVMTTAIMTKVMTVV

Conservation Score

0.137

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.798943

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.608

PhyloCSF Frame 3

0

CNTI Score

-0.258851118