McDonnell Genome Institute

Washington University

Transcript

lnc-STK32B-1:1

Chromosome

chr4

Gene Name

lnc-STK32B-1

Start

5033259

CPC Label

noncoding

End

5033704

Cancer

OV

Strand

+

Peptide

EAMVSESGACMWQR

Modified Peptide

n[145]EAM[147]VSESGACM[147]WQR

Peptide Length

14

ORF Length

52

Open Reading Frame (ORF)

MARGNPASPSRFLWTPASGKEAMVSESGACMWQRIRMARRAEAPLSTAAATS

Conservation Score

0.514

PhyloCSF Frame 1

-4.259

No. of Spectra

1

CPC Coding Probability

0.181542

PhyloCSF Frame 2 

-3.843

CNTI Index

noncoding

Max Probability

0.3831

PhyloCSF Frame 3

-5.107

CNTI Score

-0.350532383