McDonnell Genome Institute

Washington University

Transcript

lnc-STK3-2:7

Chromosome

chr8

Gene Name

lnc-STK3-2

Start

98995931

CPC Label

noncoding

End

99013029

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

LILIQLCFR

Modified Peptide

n[145]LILIQLCFR

Peptide Length

9

ORF Length

66

Open Reading Frame (ORF)

LLNLLRFGGLSVTAGSIILTNSYNRHKLILIQLCFRNVKIVINQSLLTLFLPFEKEKRKTINYYNQ

Conservation Score

0.979

PhyloCSF Frame 1

-4.078

No. of Spectra

1

CPC Coding Probability

0.0844403

PhyloCSF Frame 2 

-3.203

CNTI Index

noncoding

Max Probability

0.9993

PhyloCSF Frame 3

-4.913

CNTI Score

-0.312003729