McDonnell Genome Institute

Washington University

Transcript

lnc-STK26-6:1

Chromosome

chrX

Gene Name

lnc-STK26-6

Start

132046302

CPC Label

noncoding

End

132260492

Cancer

OV

Strand

+

Peptide

LVEDGHLQAK

Modified Peptide

n[145]LVEDGHLQAK

Peptide Length

10

ORF Length

34

Open Reading Frame (ORF)

LVEDGHLQAKKGGLRRKEHQYLGVKLPGSIIVRK

Conservation Score

0.952

PhyloCSF Frame 1

-5.465

No. of Spectra

5

CPC Coding Probability

0.10744

PhyloCSF Frame 2 

-5.385

CNTI Index

noncoding

Max Probability

0.9468

PhyloCSF Frame 3

-5.475

CNTI Score

-0.341376538