McDonnell Genome Institute

Washington University

Transcript

lnc-STK17A-1:1

Chromosome

chr7

Gene Name

lnc-STK17A-1

Start

43631159

CPC Label

noncoding

End

43643822

Cancer

OV

Strand

+

Peptide

MSELWAAVLPWVDVTLYR

Modified Peptide

n[145]MSELWAAVLPWVDVTLYR

Peptide Length

18

ORF Length

35

Open Reading Frame (ORF)

MSELWAAVLPWVDVTLYRLVPSPARPCQRLKQEFW

Conservation Score

0.037

PhyloCSF Frame 1

-5.406

No. of Spectra

5

CPC Coding Probability

0.211602

PhyloCSF Frame 2 

-5.045

CNTI Index

noncoding

Max Probability

0.8678

PhyloCSF Frame 3

-4.918

CNTI Score

-0.370525571