McDonnell Genome Institute

Washington University

Transcript

lnc-STIP1-2:1

Chromosome

chr11

Gene Name

lnc-STIP1-2

Start

64166237

CPC Label

noncoding

End

64169722

Cancer

OV

Strand

+

Peptide

AQLEQNLGQLGR

Modified Peptide

n[145]AQLEQNLGQLGR

Peptide Length

12

ORF Length

35

Open Reading Frame (ORF)

LPSNSPGAKAQLEQNLGQLGRRVEGGNSGIWRQET

Conservation Score

0.117

PhyloCSF Frame 1

-4.131

No. of Spectra

1

CPC Coding Probability

0.161618

PhyloCSF Frame 2 

-2.34

CNTI Index

noncoding

Max Probability

0.4637

PhyloCSF Frame 3

-5.224

CNTI Score

-0.282002112