McDonnell Genome Institute

Washington University

Transcript

lnc-STIM2-12:4

Chromosome

chr4

Gene Name

lnc-STIM2-12

Start

28435562

CPC Label

noncoding

End

28630351

Cancer

BRCA-Luminal B

Strand

+

Peptide

LLTVLQPGK

Modified Peptide

n[145]LLTVLQPGK

Peptide Length

9

ORF Length

58

Open Reading Frame (ORF)

LLTVLQPGKFKTSRSSGESLTPIDDVFVSSHDRRGKQSPLGFFKEDINLIHKGGPLMT

Conservation Score

0.021

PhyloCSF Frame 1

-5.203

No. of Spectra

25

CPC Coding Probability

0.0784902

PhyloCSF Frame 2 

-5.026

CNTI Index

noncoding

Max Probability

0.9971

PhyloCSF Frame 3

-4.673

CNTI Score

-0.34220694