McDonnell Genome Institute

Washington University

Transcript

lnc-STEAP1B-4:1

Chromosome

chr7

Gene Name

lnc-STEAP1B-4

Start

22356309

CPC Label

noncoding

End

22356910

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

LRDLPALLR

Modified Peptide

n[145]LRDLPALLR

Peptide Length

9

ORF Length

122

Open Reading Frame (ORF)

LRDLPALLRSGLTLRRKRSAAGGRAAPDLTPGPPDSGCGTGHRLKTSCLPLLGGEAAGVQRPTASQPCPNRKLQAPRAASLFAGRMRRVCLFWRCCCKLWASRLVLVVSTAEGQTQESEALG

Conservation Score

1

PhyloCSF Frame 1

3.418

No. of Spectra

2

CPC Coding Probability

0.0102594

PhyloCSF Frame 2 

-0.716

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

8.499

CNTI Score

-0.302859492