McDonnell Genome Institute

Washington University

Transcript

lnc-STC1-5:1

Chromosome

chr8

Gene Name

lnc-STC1-5

Start

23767726

CPC Label

noncoding

End

23782941

Cancer

OSCC

Strand

-

Peptide

SEAQTQPLTSLGMSSTSTGPFMLAQPESK

Modified Peptide

n[145]SEAQTQPLTSLGMSSTSTGPFM[147]LAQPESK

Peptide Length

29

ORF Length

78

Open Reading Frame (ORF)

LCSQLPGLRSEAQTQPLTSLGMSSTSTGPFMLAQPESKAGGKRISPNSINKRQLVFKSFPDNVKKLSQMFLERVFERM

Conservation Score

1

PhyloCSF Frame 1

-1.416

No. of Spectra

3

CPC Coding Probability

0.301895

PhyloCSF Frame 2 

-3.099

CNTI Index

noncoding

Max Probability

0.9233

PhyloCSF Frame 3

-0.948

CNTI Score

-0.348637163