McDonnell Genome Institute

Washington University

Transcript

lnc-STAT5A-2:1

Chromosome

chr17

Gene Name

lnc-STAT5A-2

Start

42276495

CPC Label

noncoding

End

42277672

Cancer

OV

Strand

+

Peptide

LGPVPFLGK

Modified Peptide

n[145]LGPVPFLGK

Peptide Length

9

ORF Length

174

Open Reading Frame (ORF)

LRRWGVFPARLPSRRRTASTCCFVWVGSTTTSRARAHCRGRFGWPPPRPAHLSPWEPRPAFRVLSRRGRGQKSTGAPINNYPGFAPGRASQPGLLPPAWARQEFTFAQAEFTCPSSRVNLRGTGRLGPVPFLGKSGWLPPVRAAGGTALSREERINRVICRIQGKGVPQILSTC

Conservation Score

1

PhyloCSF Frame 1

-1.282

No. of Spectra

7

CPC Coding Probability

0.16729

PhyloCSF Frame 2 

-1.221

CNTI Index

noncoding

Max Probability

0.971

PhyloCSF Frame 3

0.592

CNTI Score

-0.301604839