McDonnell Genome Institute

Washington University

Transcript

lnc-STAT3-1:2

Chromosome

chr17

Gene Name

lnc-STAT3-1

Start

42270516

CPC Label

noncoding

End

42271371

Cancer

OV

Strand

-

Peptide

ALLTMAHLGR

Modified Peptide

n[145]ALLTM[147]AHLGR

Peptide Length

10

ORF Length

89

Open Reading Frame (ORF)

LFSPGRGFLCIWEIRPKLPVTATSMICIKNNYSSFWARALLTMAHLGRYSDYVSNHYDATFREVSRQLTSPSNYVQNPEFEKMFQRLQV

Conservation Score

1

PhyloCSF Frame 1

-4.202

No. of Spectra

70

CPC Coding Probability

0.0439273

PhyloCSF Frame 2 

-5.362

CNTI Index

noncoding

Max Probability

0.9779

PhyloCSF Frame 3

-2.732

CNTI Score

-0.404858196