McDonnell Genome Institute

Washington University

Transcript

lnc-STARD8-2:1

Chromosome

chrX

Gene Name

lnc-STARD8-2

Start

68771321

CPC Label

coding

End

68772578

Cancer

CCRC

Strand

+

Peptide

DQEVGIPQK

Modified Peptide

n[230]DQEVGIPQK

Peptide Length

9

ORF Length

190

Open Reading Frame (ORF)

LSEPRLNTPENREYTAEVMFESFSVPGLYIAVQAVLALAASWTSRQVGGRTFTGTVIDSGDGVTHVIAMAEGYLIANCIKHIPIPGRNITYFIPQLLRDQEVGIPQKQSLETAKTIKEHYSYVCPDLVKEFNKYDTDGSKWIKQYTRINAISKKEFSIGVVSERLLGFEIFFSSRVCQSRLYITYLRNCR

Conservation Score

1

PhyloCSF Frame 1

-3.402

No. of Spectra

5

CPC Coding Probability

0.879648

PhyloCSF Frame 2 

-1.613

CNTI Index

coding

Max Probability

0.9161

PhyloCSF Frame 3

-4.162

CNTI Score

0.583775523