McDonnell Genome Institute

Washington University

Transcript

lnc-STARD6-3:1

Chromosome

chr18

Gene Name

lnc-STARD6-3

Start

54352136

CPC Label

noncoding

End

54482813

Cancer

OV

Strand

-

Peptide

KILANGK

Modified Peptide

n[145]KILANGK

Peptide Length

7

ORF Length

41

Open Reading Frame (ORF)

MKLHIQVRLLIAYSRKKVTIKKILANGKSTYRSVSIFVVIK

Conservation Score

0.858

PhyloCSF Frame 1

-4.993

No. of Spectra

16

CPC Coding Probability

0.216573

PhyloCSF Frame 2 

-4.873

CNTI Index

noncoding

Max Probability

0.9848

PhyloCSF Frame 3

-5.3

CNTI Score

-0.337945425