McDonnell Genome Institute

Washington University

Transcript

lnc-STARD5-1:2

Chromosome

chr15

Gene Name

lnc-STARD5-1

Start

81303214

CPC Label

noncoding

End

81309391

Cancer

OV

Strand

-

Peptide

NGPSGVMGSLEEK

Modified Peptide

n[145]NGPSGVM[147]GSLEEK

Peptide Length

13

ORF Length

77

Open Reading Frame (ORF)

LASLQVTSPPQTSVSSSVKNGPSGVMGSLEEKKNVCKAASIIIFLSHSPCPQPGRGSAMKSARNQHIGQCEMKSGCR

Conservation Score

0.853

PhyloCSF Frame 1

-4.719

No. of Spectra

31

CPC Coding Probability

0.0717564

PhyloCSF Frame 2 

-1.815

CNTI Index

noncoding

Max Probability

0.8955

PhyloCSF Frame 3

-2.602

CNTI Score

-0.391522266