McDonnell Genome Institute

Washington University

Transcript

lnc-STARD3NL-2:1

Chromosome

chr7

Gene Name

lnc-STARD3NL-2

Start

38311382

CPC Label

noncoding

End

38311808

Cancer

LUAD

Strand

+

Peptide

LQMGSCAYEIR

Modified Peptide

n[230]LQMGSCAYEIR

Peptide Length

11

ORF Length

45

Open Reading Frame (ORF)

LQMGSCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYNHGLSSL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0315042

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.1267

PhyloCSF Frame 3

0

CNTI Score

0.67390315