McDonnell Genome Institute

Washington University

Transcript

lnc-STARD13-5:1

Chromosome

chr13

Gene Name

lnc-STARD13-5

Start

34082428

CPC Label

noncoding

End

34083310

Cancer

BRCA-Basal-like

Strand

-

Peptide

CQSLLDSR

Modified Peptide

n[145]CQSLLDSR

Peptide Length

8

ORF Length

46

Open Reading Frame (ORF)

LWLATRLMNSSFTHVNDRTRVQWLHLPEGEQEIGERCQSLLDSRKQ

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

25

CPC Coding Probability

0.0715667

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9987

PhyloCSF Frame 3

0

CNTI Score

-0.348371661