McDonnell Genome Institute

Washington University

Transcript

lnc-STARD13-2:1

Chromosome

chr13

Gene Name

lnc-STARD13-2

Start

33355205

CPC Label

noncoding

End

33676768

Cancer

HCC

Strand

-

Peptide

ERVGSSNSSASASQVAGITGVR

Modified Peptide

n[230]ERVGSSNSSASASQVAGITGVR

Peptide Length

22

ORF Length

96

Open Reading Frame (ORF)

LESNPKKNHQKKGICRTKTANIQNLDGVPSQMSTGTQPKTKVLSDNRPKERVGSSNSSASASQVAGITGVRHCVRNWWVLGLTDFKNEAVDPRACP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.194518

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3417

PhyloCSF Frame 3

0

CNTI Score

-0.382089541