McDonnell Genome Institute

Washington University

Transcript

lnc-STARD10-1:5

Chromosome

chr11

Gene Name

lnc-STARD10-1

Start

72812445

CPC Label

noncoding

End

72814084

Cancer

CCRC

Strand

-

Peptide

GGIPAFR

Modified Peptide

n[230]GGIPAFR

Peptide Length

7

ORF Length

44

Open Reading Frame (ORF)

LAAHPARDPEALSPGLCAYTEGAAQQDSKIRKQRLKGGIPAFRG

Conservation Score

0.01

PhyloCSF Frame 1

-2.957

No. of Spectra

25

CPC Coding Probability

0.0324096

PhyloCSF Frame 2 

-2.59

CNTI Index

noncoding

Max Probability

0.9968

PhyloCSF Frame 3

-2.221

CNTI Score

-0.341961323