McDonnell Genome Institute

Washington University

Transcript

lnc-STAR-1:1

Chromosome

chr8

Gene Name

lnc-STAR-1

Start

38100876

CPC Label

noncoding

End

38105777

Cancer

OV

Strand

-

Peptide

IFVATTGYSAQKR

Modified Peptide

n[145]IFVATTGYSAQKR

Peptide Length

13

ORF Length

106

Open Reading Frame (ORF)

LEDFLSSQGLTRRIFVATTGYSAQKRVLESAGRAVPPNTPHHRMWETSSLESSTPCPPRMEFGFLRRVAPWSPFPNDFKREGNLGRPIPGARVENPGRAAEERRGH

Conservation Score

0.049

PhyloCSF Frame 1

-2.587

No. of Spectra

12

CPC Coding Probability

0.0451572

PhyloCSF Frame 2 

-2.402

CNTI Index

noncoding

Max Probability

0.9904

PhyloCSF Frame 3

-3.776

CNTI Score

-0.264402125