McDonnell Genome Institute

Washington University

Transcript

lnc-ST8SIA2-7:1

Chromosome

chr15

Gene Name

lnc-ST8SIA2-7

Start

92471653

CPC Label

coding

End

92501117

Cancer

OSCC

Strand

+

Peptide

SPDYCMLAVGGK

Modified Peptide

n[145]SPDYCM[147]LAVGGK

Peptide Length

12

ORF Length

49

Open Reading Frame (ORF)

LIPGWARFCLVGFFATAVVLVASRSPDYCMLAVGGKACLPCSLPPLHVL

Conservation Score

0.035

PhyloCSF Frame 1

-3.469

No. of Spectra

2

CPC Coding Probability

0.509837

PhyloCSF Frame 2 

-3.584

CNTI Index

coding

Max Probability

0.8247

PhyloCSF Frame 3

-3.99

CNTI Score

0.627470441