McDonnell Genome Institute

Washington University

Transcript

lnc-ST8SIA2-3:1

Chromosome

chr15

Gene Name

lnc-ST8SIA2-3

Start

92602909

CPC Label

coding

End

92620015

Cancer

OV

Strand

+

Peptide

LENFFCDSPERK

Modified Peptide

n[145]LENFFCDSPERK

Peptide Length

12

ORF Length

55

Open Reading Frame (ORF)

LENFFCDSPERKYCKLCRSHNHGDNSSTLLLGWNSSHSKKCLAMAVFQYNVIYRH

Conservation Score

0.076

PhyloCSF Frame 1

-5.282

No. of Spectra

1

CPC Coding Probability

0.516053

PhyloCSF Frame 2 

-4.957

CNTI Index

noncoding

Max Probability

0.6954

PhyloCSF Frame 3

-3.313

CNTI Score

-0.362652755