McDonnell Genome Institute

Washington University

Transcript

lnc-ST7L-4:1

Chromosome

chr1

Gene Name

lnc-ST7L-4

Start

112517798

CPC Label

noncoding

End

112518441

Cancer

OV

Strand

-

Peptide

LVCSLSLGQIMCFPTYYSLIR

Modified Peptide

n[145]LVCSLSLGQIM[147]CFPTYYSLIR

Peptide Length

21

ORF Length

40

Open Reading Frame (ORF)

LVCSLSLGQIMCFPTYYSLIRNCPLVSQAIQILPTLQGAA

Conservation Score

0.602

PhyloCSF Frame 1

-5.45

No. of Spectra

26

CPC Coding Probability

0.351341

PhyloCSF Frame 2 

-5.449

CNTI Index

noncoding

Max Probability

0.9801

PhyloCSF Frame 3

-4.293

CNTI Score

-0.38638735