McDonnell Genome Institute

Washington University

Transcript

lnc-ST7L-2:6

Chromosome

chr1

Gene Name

lnc-ST7L-2

Start

112229556

CPC Label

noncoding

End

112360607

Cancer

BRCA-Basal-like

Strand

-

Peptide

FETLLSK

Modified Peptide

n[145]FETLLSK

Peptide Length

7

ORF Length

129

Open Reading Frame (ORF)

LTFVLKFETLLSKSQHTNLNFICNITSLSLGHISQGDGERNRGDKNIVTTVFTWLHFTLSCNCPELRSCLLRSSTIAFLRFSLPCSPVAFCLSISETAGSAAFVRVFFFHGPFVCGLSGLLESYPLINY

Conservation Score

0.997

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.141825

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9986

PhyloCSF Frame 3

0

CNTI Score

-0.354661706