McDonnell Genome Institute

Washington University

Transcript

lnc-ST5-2:1

Chromosome

chr11

Gene Name

lnc-ST5-2

Start

8679309

CPC Label

noncoding

End

8680737

Cancer

OV

Strand

-

Peptide

VQHYQPHFTCVK

Modified Peptide

n[145]VQHYQPHFTCVK

Peptide Length

12

ORF Length

63

Open Reading Frame (ORF)

LNTSVHKDNNQHFQSTWQFTKYICLKVQHYQPHFTCVKTEAQKNWVTCQTLHRWSGTEPGPSL

Conservation Score

1

PhyloCSF Frame 1

-4.401

No. of Spectra

3

CPC Coding Probability

0.0039466

PhyloCSF Frame 2 

-4.526

CNTI Index

noncoding

Max Probability

0.7094

PhyloCSF Frame 3

-2.811

CNTI Score

-0.355236051