McDonnell Genome Institute

Washington University

Transcript

lnc-ST3GAL6-1:4

Chromosome

chr3

Gene Name

lnc-ST3GAL6-1

Start

98902101

CPC Label

noncoding

End

98912072

Cancer

CCRC

Strand

+

Peptide

AGGGGQK

Modified Peptide

n[230]AGGGGQK

Peptide Length

7

ORF Length

35

Open Reading Frame (ORF)

MAGGGGQKSVKQDPCRKGNLNLTSQPSCSHSTRSC

Conservation Score

0.221

PhyloCSF Frame 1

-4.984

No. of Spectra

24

CPC Coding Probability

0.080884

PhyloCSF Frame 2 

-5.043

CNTI Index

noncoding

Max Probability

0.9941

PhyloCSF Frame 3

-3.342

CNTI Score

-0.328989629