McDonnell Genome Institute

Washington University

Transcript

lnc-ST3GAL6-1:3

Chromosome

chr3

Gene Name

lnc-ST3GAL6-1

Start

98902013

CPC Label

noncoding

End

98912015

Cancer

EOGC

Strand

+

Peptide

FTALNAHIK

Modified Peptide

n[145]FTALNAHIK

Peptide Length

9

ORF Length

188

Open Reading Frame (ORF)

LNSVLGQVDLTDICRTLHLKTTEYVFFSLPHGTYSKVDHIIRSKTLLSKCKRTEIINSLSNHHAIKLELKIKKFTQNHTTTWKLNNLLLNDSWVNNEIKAENKKFFETNENEETMNQNLWDTVKAMLRGKFTALNAHIKKLERCQVNKLTLQLKELENQEQTNPKASRRQEISKIRTEMKELETQKTH

Conservation Score

0.787

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.080884

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0967

PhyloCSF Frame 3

0

CNTI Score

-0.328989629