McDonnell Genome Institute

Washington University

Transcript

lnc-ST3GAL4-5:1

Chromosome

chr11

Gene Name

lnc-ST3GAL4-5

Start

126702545

CPC Label

noncoding

End

126709151

Cancer

CCRC

Strand

+

Peptide

QAGGLLK

Modified Peptide

n[230]QAGGLLK

Peptide Length

7

ORF Length

47

Open Reading Frame (ORF)

LVTKQAGGLLKEDTGILNRPSPKGSSILLLRPCHGMKASALYVWPPC

Conservation Score

0.062

PhyloCSF Frame 1

-3.932

No. of Spectra

23

CPC Coding Probability

0.0846507

PhyloCSF Frame 2 

-4.695

CNTI Index

noncoding

Max Probability

0.9978

PhyloCSF Frame 3

-4.248

CNTI Score

-0.363865874