McDonnell Genome Institute

Washington University

Transcript

lnc-ST3GAL4-3:1

Chromosome

chr11

Gene Name

lnc-ST3GAL4-3

Start

126526979

CPC Label

noncoding

End

126604789

Cancer

OV

Strand

+

Peptide

LPGNRIRSGEAMCFEK

Modified Peptide

n[145]LPGNRIRSGEAM[147]CFEK

Peptide Length

16

ORF Length

71

Open Reading Frame (ORF)

LPGNRIRSGEAMCFEKVSGLDLQEREVIKGEGQEGEVKVVCVCAHMWVYVCMCIHVCRCVHACVHVYIFPK

Conservation Score

0.069

PhyloCSF Frame 1

0

No. of Spectra

20

CPC Coding Probability

0.460393

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.996

PhyloCSF Frame 3

0

CNTI Score

-0.350428756