McDonnell Genome Institute

Washington University

Transcript

lnc-ST3GAL1-4:1

Chromosome

chr8

Gene Name

lnc-ST3GAL1-4

Start

133962991

CPC Label

noncoding

End

133963259

Cancer

HCC

Strand

-

Peptide

SCLLNFCLLIPLLEK

Modified Peptide

SCLLNFCLLIPLLEK

Peptide Length

15

ORF Length

41

Open Reading Frame (ORF)

LSTEGERDSSKSCLLNFCLLIPLLEKWISYQHKNMLKTNIE

Conservation Score

0.998

PhyloCSF Frame 1

-3.994

No. of Spectra

79

CPC Coding Probability

0.0000109

PhyloCSF Frame 2 

-3.653

CNTI Index

noncoding

Max Probability

0.9648

PhyloCSF Frame 3

-4.657

CNTI Score

-0.451139608