McDonnell Genome Institute

Washington University

Transcript

lnc-ST3GAL1-1:2

Chromosome

chr8

Gene Name

lnc-ST3GAL1-1

Start

133362498

CPC Label

noncoding

End

133409470

Cancer

EOGC

Strand

-

Peptide

ISLSIPAIPDMPPPIPGIPLK

Modified Peptide

n[145]ISLSIPAIPDMPPPIPGIPLK

Peptide Length

21

ORF Length

43

Open Reading Frame (ORF)

MAARTSGSLRISLSIPAIPDMPPPIPGIPLKALSENKIYFHFQ

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0167811

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5936

PhyloCSF Frame 3

0

CNTI Score

-0.416446533