McDonnell Genome Institute

Washington University

Transcript

lnc-SSX4B-1:1

Chromosome

chrX

Gene Name

lnc-SSX4B-1

Start

48380149

CPC Label

coding

End

48383123

Cancer

LUAD

Strand

-

Peptide

LCCLESVCLR

Modified Peptide

LCCLESVCLR

Peptide Length

10

ORF Length

53

Open Reading Frame (ORF)

LCCLESVCLRLRDNGLLAKPTHGDIIRFHLCWWSRRMRFQGQLLSLTRPSCRS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.827988

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8862

PhyloCSF Frame 3

0

CNTI Score

-0.345091604