McDonnell Genome Institute

Washington University

Transcript

lnc-SSX1-1:1

Chromosome

chrX

Gene Name

lnc-SSX1-1

Start

48244893

CPC Label

noncoding

End

48245745

Cancer

HCC

Strand

+

Peptide

MGIILRNEPMKLPSDVVTAVR

Modified Peptide

n[43]MGIILRNEPMKLPSDVVTAVR

Peptide Length

21

ORF Length

37

Open Reading Frame (ORF)

MGIILRNEPMKLPSDVVTAVRGKRIIKCYCYSRQQRL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0301736

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8659

PhyloCSF Frame 3

0

CNTI Score

-0.37534441