McDonnell Genome Institute

Washington University

Transcript

lnc-SSUH2-3:1

Chromosome

chr3

Gene Name

lnc-SSUH2-3

Start

8364706

CPC Label

noncoding

End

8366392

Cancer

OV

Strand

-

Peptide

QADDILIAGPTR

Modified Peptide

n[145]QADDILIAGPTR

Peptide Length

12

ORF Length

48

Open Reading Frame (ORF)

MHGLQRYISVPFSIPKAIFLRDWKIRRRQADDILIAGPTRRGIVELSG

Conservation Score

1

PhyloCSF Frame 1

-4.268

No. of Spectra

1

CPC Coding Probability

0.0699993

PhyloCSF Frame 2 

-4.327

CNTI Index

noncoding

Max Probability

0.4083

PhyloCSF Frame 3

-5.479

CNTI Score

-0.378351658