McDonnell Genome Institute

Washington University

Transcript

lnc-SSU72P8-2:1

Chromosome

chr7

Gene Name

lnc-SSU72P8-2

Start

125917870

CPC Label

noncoding

End

125933832

Cancer

LUAD

Strand

+

Peptide

TQVFLESAAVR

Modified Peptide

‚Äč

Peptide Length

11

ORF Length

58

Open Reading Frame (ORF)

LVKTQVFLESAAVRHEEKTVHVYTVDLEGKAESIQHFLHEENKIIGVYSSPPRIWDVT

Conservation Score

0.034

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0398608

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7429

PhyloCSF Frame 3

0

CNTI Score

-0.421926999