McDonnell Genome Institute

Washington University

Transcript

lnc-SSU72P5-2:6

Chromosome

chr11

Gene Name

lnc-SSU72P5-2

Start

4187141

CPC Label

noncoding

End

4204965

Cancer

LUAD

Strand

+

Peptide

RHNTNLAAER

Modified Peptide

Peptide Length

10

ORF Length

64

Open Reading Frame (ORF)

LFMRRGSLKGRCHCCSLLLPHASQKGPQARNRERGSCVYATCRRHNTNLAAEREKEKVIIRHSE

Conservation Score

0.953

PhyloCSF Frame 1

-4.645

No. of Spectra

5

CPC Coding Probability

0.378136

PhyloCSF Frame 2 

-3.138

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

-4.077

CNTI Score

-0.329550802