McDonnell Genome Institute

Washington University

Transcript

lnc-SSTR4-2:2

Chromosome

chr20

Gene Name

lnc-SSTR4-2

Start

23180131

CPC Label

noncoding

End

23190298

Cancer

OV

Strand

+

Peptide

KISQVTVR

Modified Peptide

n[145]KISQVTVR

Peptide Length

8

ORF Length

61

Open Reading Frame (ORF)

LGNNPKERDRAFIKQHVSISAVAVPRAHFLDIASCLDQPFRKISQVTVRVKAGGHWRLQGL

Conservation Score

0.924

PhyloCSF Frame 1

-4.463

No. of Spectra

5

CPC Coding Probability

0.0649606

PhyloCSF Frame 2 

-5.101

CNTI Index

noncoding

Max Probability

0.923

PhyloCSF Frame 3

-4.163

CNTI Score

-0.340593803