McDonnell Genome Institute

Washington University

Transcript

lnc-SSTR4-1:3

Chromosome

chr20

Gene Name

lnc-SSTR4-1

Start

23037719

CPC Label

noncoding

End

23039236

Cancer

OV

Strand

+

Peptide

EWVAMSVLHTGDMTVEWK

Modified Peptide

n[145]EWVAM[147]SVLHTGDMTVEWK

Peptide Length

18

ORF Length

57

Open Reading Frame (ORF)

MIILVVWGRWCGEGERQPKVNTLCPSEWSASQTTLREWVAMSVLHTGDMTVEWKFQN

Conservation Score

0.14

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0311563

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.744

PhyloCSF Frame 3

0

CNTI Score

-0.330828623