McDonnell Genome Institute

Washington University

Transcript

lnc-SSTR3-2:1

Chromosome

chr22

Gene Name

lnc-SSTR3-2

Start

37225263

CPC Label

noncoding

End

37225995

Cancer

PRAD

Strand

-

Peptide

FAGAASQAPHAPAFLR

Modified Peptide

‚Äč

Peptide Length

16

ORF Length

183

Open Reading Frame (ORF)

LQSFVDGLFCTGGLLRPGTCKFAGAASQAPHAPAFLRARGEPQDPLSHPRVPAVSANCRMWKHLPVHSSPTPRLTPLWKLQARWLLPQLVYLQGWGSYSLLRPAALISMVLLAREFLYPAKMSVSEVCSSGLSSPLLEQHKTNLIFYASGDICSANGKSGFNQPLPFLKTFCCTHRILSCTYL

Conservation Score

1

PhyloCSF Frame 1

-3.643

No. of Spectra

1

CPC Coding Probability

0.296658

PhyloCSF Frame 2 

-2.561

CNTI Index

noncoding

Max Probability

0.74

PhyloCSF Frame 3

-1.641

CNTI Score

-0.35501728