McDonnell Genome Institute

Washington University

Transcript

lnc-SSTR2-3:1

Chromosome

chr17

Gene Name

lnc-SSTR2-3

Start

72839038

CPC Label

noncoding

End

72839718

Cancer

OSCC

Strand

+

Peptide

ISGLHSEDTFGLCGWPNDGSK

Modified Peptide

n[145]ISGLHSEDTFGLCGWPNDGSK

Peptide Length

21

ORF Length

38

Open Reading Frame (ORF)

MLAAEDISELKLRISGLHSEDTFGLCGWPNDGSKYIQI

Conservation Score

0.014

PhyloCSF Frame 1

-6.203

No. of Spectra

4

CPC Coding Probability

0.0176573

PhyloCSF Frame 2 

-4.302

CNTI Index

noncoding

Max Probability

0.8157

PhyloCSF Frame 3

-6.201

CNTI Score

-0.354226599