McDonnell Genome Institute

Washington University

Transcript

lnc-SSTR1-3:2

Chromosome

chr14

Gene Name

lnc-SSTR1-3

Start

37916506

CPC Label

noncoding

End

37928091

Cancer

EOGC

Strand

+

Peptide

DNLLNSLVVMHFTK

Modified Peptide

n[145]DNLLNSLVVM[147]HFTK

Peptide Length

14

ORF Length

42

Open Reading Frame (ORF)

LKGPKSCRAEFWRNKQNKDNLLNSLVVMHFTKVAFRGLRSLR

Conservation Score

1

PhyloCSF Frame 1

-5.269

No. of Spectra

2

CPC Coding Probability

0.0318122

PhyloCSF Frame 2 

-4.613

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

-4.582

CNTI Score

-0.3723395