McDonnell Genome Institute

Washington University

Transcript

lnc-SSR3-7:1

Chromosome

chr3

Gene Name

lnc-SSR3-7

Start

156641441

CPC Label

noncoding

End

156665963

Cancer

OV

Strand

-

Peptide

LLQVVAGHASSEK

Modified Peptide

n[145]LLQVVAGHASSEK

Peptide Length

13

ORF Length

53

Open Reading Frame (ORF)

LLQVVAGHASSEKNGHDLCLRVAYGRRRINSNNHSNQLTTVNFNKCFGRSLSW

Conservation Score

0.126

PhyloCSF Frame 1

-3.843

No. of Spectra

4

CPC Coding Probability

0.113

PhyloCSF Frame 2 

-5.798

CNTI Index

noncoding

Max Probability

0.8946

PhyloCSF Frame 3

-5.191

CNTI Score

-0.34964737