McDonnell Genome Institute

Washington University

Transcript

lnc-SSR1-2:1

Chromosome

chr6

Gene Name

lnc-SSR1-2

Start

6938601

CPC Label

noncoding

End

6938897

Cancer

OV

Strand

-

Peptide

LAQVEMK

Modified Peptide

n[145]LAQVEM[147]K

Peptide Length

7

ORF Length

38

Open Reading Frame (ORF)

LAQVEMKRVRTPVLISSGITPVYSHCTPARATGDSIFF

Conservation Score

0.065

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.120262

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8356

PhyloCSF Frame 3

0

CNTI Score

-0.417323221