McDonnell Genome Institute

Washington University

Transcript

lnc-SSPN-2:1

Chromosome

chr12

Gene Name

lnc-SSPN-2

Start

26318952

CPC Label

noncoding

End

26421462

Cancer

EOGC

Strand

+

Peptide

MDLLSTR

Modified Peptide

n[145]MDLLSTR

Peptide Length

7

ORF Length

67

Open Reading Frame (ORF)

MDLLSTRSSALLTNWHVNIIHAKLASFAVPGRERMEMSRDLFLILCFYHGLCLLSTILNKFWFLFHF

Conservation Score

0.427

PhyloCSF Frame 1

-2.937

No. of Spectra

1

CPC Coding Probability

0.0342449

PhyloCSF Frame 2 

-4.646

CNTI Index

noncoding

Max Probability

0.9975

PhyloCSF Frame 3

-5.257

CNTI Score

-0.405958676