McDonnell Genome Institute

Washington University

Transcript

lnc-SSH3-5:1

Chromosome

chr11

Gene Name

lnc-SSH3-5

Start

67353582

CPC Label

coding

End

67359395

Cancer

BRCA-Luminal B

Strand

+

Peptide

LPILSLGK

Modified Peptide

n[145]LPILSLGK

Peptide Length

8

ORF Length

148

Open Reading Frame (ORF)

LPILSLGKCPLLQSVPPSEMLRNVTAHGDRSTAKVPADITGFYLAAQTPFGSPVVVSLFHSLNLPIFLHPPPTHSAITCLDHFYLTTTTTKQTKAFCDLANLSRWCFFVCVFFETVSLLSPRLECSGGILAHCSLHLPGSSDSPALAS

Conservation Score

0.582

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.685444

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9948

PhyloCSF Frame 3

0

CNTI Score

-0.331753726