McDonnell Genome Institute

Washington University

Transcript

lnc-SSH3-4:1

Chromosome

chr11

Gene Name

lnc-SSH3-4

Start

67296627

CPC Label

noncoding

End

67298056

Cancer

OV

Strand

+

Peptide

AWPGLYLCLISFLVFFFFSER

Modified Peptide

n[145]AWPGLYLCLISFLVFFFFSER

Peptide Length

21

ORF Length

113

Open Reading Frame (ORF)

LFLVEMGFHHVAQAGLELLCSSNLPVSASQSAGITGVSHRAWPGLYLCLISFLVFFFFSERESCSVAQAGVQWHDLGLLQAPPPGFTPFSWLSLPSSWDYRRLPPRPANFLYF

Conservation Score

0.03

PhyloCSF Frame 1

0

No. of Spectra

32

CPC Coding Probability

0.36765

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.942

PhyloCSF Frame 3

0

CNTI Score

-0.396279856