McDonnell Genome Institute

Washington University

Transcript

lnc-SSBP4-2:1

Chromosome

chr19

Gene Name

lnc-SSBP4-2

Start

18441109

CPC Label

noncoding

End

18444432

Cancer

OV

Strand

+

Peptide

LSWENSVAR

Modified Peptide

n[145]LSWENSVAR

Peptide Length

9

ORF Length

37

Open Reading Frame (ORF)

MLSWENSVARLCWEQGTRCPTGLHDFPSRAPQIPGWP

Conservation Score

0.908

PhyloCSF Frame 1

-4.605

No. of Spectra

3

CPC Coding Probability

0.23074

PhyloCSF Frame 2 

-5.695

CNTI Index

noncoding

Max Probability

0.7713

PhyloCSF Frame 3

-4.328

CNTI Score

-0.309540047