McDonnell Genome Institute

Washington University

Transcript

lnc-SSBP1-2:1

Chromosome

chr7

Gene Name

lnc-SSBP1-2

Start

141787814

CPC Label

noncoding

End

141788640

Cancer

OV

Strand

+

Peptide

SVIFIDCCPVK

Modified Peptide

n[145]SVIFIDCCPVK

Peptide Length

11

ORF Length

54

Open Reading Frame (ORF)

LFFASVFQDHFLFLSSCWLDPLKTLNRKQQHPASHFKSVIFIDCCPVKETDCYL

Conservation Score

0.79

PhyloCSF Frame 1

-5.698

No. of Spectra

2

CPC Coding Probability

0.0239655

PhyloCSF Frame 2 

-4.79

CNTI Index

noncoding

Max Probability

0.8507

PhyloCSF Frame 3

-4.309

CNTI Score

-0.419280831