McDonnell Genome Institute

Washington University

Transcript

lnc-SS18L2-4:1

Chromosome

chr3

Gene Name

lnc-SS18L2-4

Start

42489479

CPC Label

noncoding

End

42500416

Cancer

EOGC

Strand

+

Peptide

LEQLGYGR

Modified Peptide

n[145]LEQLGYGR

Peptide Length

8

ORF Length

89

Open Reading Frame (ORF)

LACARLEQLGYGRTSSPTVWTVRKGGSPRRTILKEQRSDVYSEESARKQLFLIHLLPSGEQGLQRHQMPSQPLTASNLAIQPSNRGEEG

Conservation Score

0.979

PhyloCSF Frame 1

-4.693

No. of Spectra

18

CPC Coding Probability

0.0123317

PhyloCSF Frame 2 

-2.97

CNTI Index

noncoding

Max Probability

0.9985

PhyloCSF Frame 3

-5.226

CNTI Score

-0.388957082