McDonnell Genome Institute

Washington University

Transcript

lnc-SS18-6:1

Chromosome

chr18

Gene Name

lnc-SS18-6

Start

25333247

CPC Label

noncoding

End

25334104

Cancer

BRCA-Luminal B

Strand

-

Peptide

MSPGPSAHPLR

Modified Peptide

n[145]M[147]SPGPSAHPLR

Peptide Length

11

ORF Length

80

Open Reading Frame (ORF)

MVFQRQDVLFFWVVLAKCKVSNVLDFKKIQTATAELTRLFSLLFSFKSKMSPGPSAHPLRICSLRVYIYIYICVYIYIYI

Conservation Score

0.089

PhyloCSF Frame 1

-5.43

No. of Spectra

4

CPC Coding Probability

0.0691125

PhyloCSF Frame 2 

-5.8

CNTI Index

noncoding

Max Probability

0.9977

PhyloCSF Frame 3

-5.022

CNTI Score

-0.379154466